DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and Acadsb

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_008758088.1 Gene:Acadsb / 25618 RGDID:2013 Length:449 Species:Rattus norvegicus


Alignment Length:277 Identity:56/277 - (20%)
Similarity:102/277 - (36%) Gaps:75/277 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DLQKERAAAEFHVEEFSAWWHGGQDKLKKKREIEKAIFSDLEDGYGLNHEYMSHEEVYNSTVKKV 79
            |:..::|..:|..|:.:.......:..|.::.:.:.:|.....|..:..:|...|..:..:|..:
  Rat    61 DIMMQKAVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGMMGIEVEAKYGGTEASFLCSVLVI 125

  Fly    80 AEAAVKLKA-------LQNKLNPGGTDIWPGGLFNAQSFGLFPANHPIATHITMFVDVIKGQGTA 137
            .|.| |:.|       :||                                 |:...:.:..||.
  Rat   126 EELA-KVDASVALLCDIQN---------------------------------TVINKLFRKHGTE 156

  Fly   138 EQ---------VEKWGKAAENCNIIGTYAQTELAHGTNVRGLATRADFDPKTDEFVLNTPNLEAY 193
            ||         .||          :|::..:|...|::...|.|||  |...:.:|:|     ..
  Rat   157 EQKATYLPKLVTEK----------LGSFCLSEAGAGSDSFALKTRA--DKSGNYYVIN-----GS 204

  Fly   194 KWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSETHMPLPGVDIGEIGKKLGMASVNQG 258
            |.|.....| |...:|.|.:.....:.|:..|:|. ||:|      |..||....|:|:.:.:..
  Rat   205 KMWISNAEH-AELFLVFANVDPPSGYRGITCFLVD-RDTE------GFQIGRRENKMGIRASSTC 261

  Fly   259 FLGLNHVRIPRTNMLMK 275
            .|...:|::|.|::|.|
  Rat   262 QLTFENVKVPETSVLGK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 56/277 (20%)
PLN02443 16..677 CDD:178062 55/276 (20%)
AcadsbXP_008758088.1 CaiA 57..409 CDD:224871 56/277 (20%)
SCAD_SBCAD 59..409 CDD:173847 56/277 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.