DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-d and acdh-4

DIOPT Version :9

Sequence 1:NP_523803.1 Gene:Acox57D-d / 37446 FlyBaseID:FBgn0034629 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:161 Identity:42/161 - (26%)
Similarity:73/161 - (45%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IATHITMFVDVIKGQGTAEQVEKWGKAAENC--NIIGTYAQTELAHGTNVRGLATRADFDPKTDE 182
            :..|.|:|:.:|...||.:|.||:   ...|  :.:|::|.:|...|::...|.|.|..|  .|:
 Worm   123 VDVHNTLFIPLIIELGTEKQKEKY---LPKCYTSSVGSFALSETGSGSDAFALKTTAKKD--GDD 182

  Fly   183 FVLNTPNLEAYKWWPGGLGHTANHAMVVAQLYIADVHHGVQMFIVPLRDSETHMPLPGVDIGEIG 247
            :|:|     ..|.|... ...:...:|.|....:..:.|:..|||       .....|..||:..
 Worm   183 YVIN-----GSKMWISN-SEQSETFLVFANADPSKGYKGITCFIV-------EKGTKGFTIGKHE 234

  Fly   248 KKLGMASVNQGFLGLNHVRIPRTNMLMKFAK 278
            .|||:.|.:...|..::||:.::.:|.:|.|
 Worm   235 DKLGVRSSSTCPLHFDNVRVHKSAILGEFGK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-dNP_523803.1 ACAD 14..653 CDD:299127 42/161 (26%)
PLN02443 16..677 CDD:178062 42/161 (26%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 42/161 (26%)
ACAD 43..359 CDD:299127 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.