DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-p and IVD

DIOPT Version :9

Sequence 1:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster
Sequence 2:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens


Alignment Length:464 Identity:93/464 - (20%)
Similarity:149/464 - (32%) Gaps:142/464 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AASFNSEEFAAWW--AGGEEVLKFNRGVR------EYMEKDVDLSEM------LQLQNKTHEEI- 71
            ||..:|..|..:|  .|...||.....|:      .|:|..:.:.|:      :.|....|..: 
Human   101 AAWKSSHSFLEFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLVMEEISRASGAVGLSYGAHSNLC 165

  Fly    72 IEFSTRGAIEGAKK--LRRL----------QEERNPGGDV--------------------YW-PN 103
            |....|...|..|:  |.:|          ..|.|.|.||                    :| .|
Human   166 INQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVSMKLKAEKKGNHYILNGNKFWITN 230

  Fly   104 LYDAQVM-------WGLVPGGNPFGVMYVMLVKALQAQCTPEQYEEFGKRVE-----LFEICGTY 156
            ..||.|:       ...||...  |:...::.|.:....|.::.::.|.|..     :||.|...
Human   231 GPDADVLIVYAKTDLAAVPASR--GITAFIVEKGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIP 293

  Fly   157 AQTELGH---GTYLRGLETRADFDRKTDQFVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYIDGD 218
            |...|||   |.|:  |.:..|.:|                             ||:|       
Human   294 AANILGHENKGVYV--LMSGLDLER-----------------------------LVLA------- 320

  Fly   219 CKGPHMFFIQVRDEDTHEPLPGVHIGD-IGKKMGFIGVNNGFLGLKNVRIPRTRMLMRHAQVKAD 282
             .||......|.|    ..:|.:|:.: .|:|:|...:..|.:.....|:...|..:.:.....|
Human   321 -GGPLGLMQAVLD----HTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQYVYNVAKACD 380

  Fly   283 GSYVSSP--TNVLTYFAMVRTRCVIAKNNAVMLASAATIATRYSAVRRQSPINPNEREPQI-MDH 344
            ..:.::.  ..|:.|.|...|:        |.|.........:||  :..|....|...|. ::.
Human   381 EGHCTAKDCAGVILYSAECATQ--------VALDGIQCFGQTFSA--QHPPGREGETRGQTSLEQ 435

  Fly   345 VTQQMK-----LFPEIATSVAYRKAGDYLWNLYDVTIEDIENGKYERLPELHSLSCALKVTCSMD 404
            |:...:     |.||:...|...:...:        |.|      ::||.|..|.|: ..:....
Human   436 VSTARELRCKILLPELTPRVLLPQLASW--------ISD------QKLPFLKILLCS-PTSLGQS 485

  Fly   405 SASGVEKLR 413
            |.:|..|||
Human   486 SLAGFTKLR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 93/464 (20%)
PLN02443 16..677 CDD:178062 93/464 (20%)
IVDXP_016877638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.