DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-p and Gcdh

DIOPT Version :9

Sequence 1:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001102366.1 Gene:Gcdh / 364975 RGDID:1308829 Length:447 Species:Rattus norvegicus


Alignment Length:499 Identity:90/499 - (18%)
Similarity:172/499 - (34%) Gaps:139/499 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AAWWAGGEEVLKFNRGVREYME----------KDVDLSE---------MLQLQNKTHEEIIEFST 76
            :||....:..|:|:|..|.:..          :.|..|.         :|:.|....|::|..:.
  Rat    16 SAWLLSRKLGLRFSRVPRTWSSAAAHTEKTQIRSVKSSRPVFDWKDPLVLEEQLTADEKLIRDTF 80

  Fly    77 RGAIEGAKKLRRLQEERNPGGDVYWPNL-YDAQVMWGLVPGGNPFG------VMYVMLVKALQ-- 132
            |...:.....|.|...||   :|:..:: |:...:..|.|....:|      |.|.:|.:.|:  
  Rat    81 RNYCQERLMSRILLANRN---EVFHRDIVYEMGELGVLGPTIKGYGCAGVSSVAYGLLTRELERV 142

  Fly   133 --------------------AQCTPEQYEEFGKRVELFEICGTYAQTELGHGTYLRGLETRADFD 177
                                ...:.||.:::..|:...|:.|.:..||..||:....:||||..:
  Rat   143 DSGYRSMMSVQSSLVMHPIYTYGSEEQRQKYLPRLAKGELLGCFGLTEPNHGSDPGSMETRARHN 207

  Fly   178 RKTDQFVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYIDGDCKGPHMFFIQVRDEDT-------H 235
            .....:.|     |..|.|   :.:|.     :|.|::           :..|.||.       .
  Rat   208 PSNKSYTL-----SGTKTW---ITNSP-----VADLFV-----------VWARCEDNCIRGFLLE 248

  Fly   236 EPLPGVHIGDIGKKMGFIGVNNGFLGLKNVRIPRTRMLMRHAQVKADGSYVSSPTNVLTYFAMVR 300
            :.:.|:....|..|........|.:.:.:|.:|...:|...:.:......:::....:|:     
  Rat   249 KGMRGLSAPRIEGKFSLRASATGMIIMDSVEVPEENVLPNVSSLAGPFGCLNTARYGITW----- 308

  Fly   301 TRCVIAKNNAVMLASAATI--ATRYSAVRRQSPINPNEREPQIMDHVTQQMKLFPEIATSVAYRK 363
                     .|:.|:...:  |.:|:..|.|..:                    |.....:..:|
  Rat   309 ---------GVLGAAEFCLHTARQYALDRIQFGV--------------------PLARNQLVQKK 344

  Fly   364 AGDYLWNLYDVTI---EDIENGKY----ERLPELHSLSCALKVTCSMDSASGVEKLRLACGGHGF 421
            ..|.   |.::|:   ..::.|:.    :..||:.||........::|.|   .:.|...||:|.
  Rat   345 LADM---LTEITLGLHACLQLGRLKDQDKATPEMVSLLKRNNCGKALDIA---RQARDILGGNGI 403

  Fly   422 LTSSNMSSIYVSATAACTYEGENTVLLLQIGRFLMKTWRAALTG 465
            ....::....::..|..||||.:.:..|.:||        |:||
  Rat   404 SDEYHVIRHAMNLEAVNTYEGTHDIHALILGR--------AITG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 90/499 (18%)
PLN02443 16..677 CDD:178062 90/499 (18%)
GcdhNP_001102366.1 GCD 57..443 CDD:173840 82/458 (18%)
CaiA 69..443 CDD:224871 80/446 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.