DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-p and ACADSB

DIOPT Version :9

Sequence 1:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_001600.1 Gene:ACADSB / 36 HGNCID:91 Length:432 Species:Homo sapiens


Alignment Length:314 Identity:74/314 - (23%)
Similarity:112/314 - (35%) Gaps:63/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 EICGTYAQTELGHGTYLRGLETRADFDRKTDQFVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYI 215
            |..|::..:|.|.|:....|:|||  |::.|.:|||     ..|.|.....|:... ||||.:..
Human   169 EKVGSFCLSEAGAGSDSFALKTRA--DKEGDYYVLN-----GSKMWISSAEHAGLF-LVMANVDP 225

  Fly   216 DGDCKGPHMFFIQVRDEDTHEPLPGVHIGDIGKKMGFIGVNNGFLGLKNVRIPRTRML--MRHAQ 278
            ....||...|.:   |.||    ||:|||....|:|....:...|..:||::|...:|  :.|..
Human   226 TIGYKGITSFLV---DRDT----PGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIGHGY 283

  Fly   279 VKADGSYVSSPTNVLTYFAMVRTRCVIAKNNAVMLASAATIATRYSAVRRQSPINPNER------ 337
            ..|.||.......:                 |..:...|.....|:....:..|...:|      
Human   284 KYAIGSLNEGRIGI-----------------AAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQG 331

  Fly   338 -EPQIMDHVTQQMKLFPEIATSVAYRKAGDYLWNLYDVTIEDIENGKYERLPELHSLSCALKVTC 401
             :.|:. ||..|:    |.|..:.|..|            ..:|.||    |.:...|.| |...
Human   332 LQHQVA-HVATQL----EAARLLTYNAA------------RLLEAGK----PFIKEASMA-KYYA 374

  Fly   402 SMDSASGVEKLRLACGGHGFLTSSNMSSIYVSATAACTYEGENTVLLLQIGRFL 455
            |..:.....|.....||.|:.....:...:..|.....|||.:.:.|..|.:.:
Human   375 SEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 74/314 (24%)
PLN02443 16..677 CDD:178062 74/314 (24%)
ACADSBNP_001600.1 CaiA 57..428 CDD:224871 74/312 (24%)
SCAD_SBCAD 59..430 CDD:173847 74/314 (24%)
Substrate binding. /evidence=ECO:0000269|Ref.15 291..294 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.