DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-p and Acadm

DIOPT Version :9

Sequence 1:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_058682.2 Gene:Acadm / 24158 RGDID:2012 Length:421 Species:Rattus norvegicus


Alignment Length:336 Identity:75/336 - (22%)
Similarity:138/336 - (41%) Gaps:48/336 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 NPFGVMYVMLVKALQAQCTPEQYEEFGKRVELFEICGTYAQTELGHGTYLRGLETRADFDRKTDQ 182
            |..|.|.|::     |....::.:..|:..|...:| .|..||...|:.:.|::|:|  ::|.|:
  Rat   126 NSLGQMPVII-----AGNDQQKKKYLGRMTEQLMMC-AYCVTEPSAGSDVAGIKTKA--EKKGDE 182

  Fly   183 FVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYIDGDCKGPHMFFIQVRDEDTHEPLPGVHIGDIG 247
            :|:|     ..|.|... |..:|...|:.:...|........|...:.:.||    ||:|||...
  Rat   183 YVIN-----GQKMWITN-GGKANWYFVLTRSNPDPKVPASKAFTGFIVEADT----PGIHIGKKE 237

  Fly   248 KKMGFIGVNNGFLGLKNVRIPRTRMLMRHAQVKADGSYVSSPTNVLTYFAMVRTRCVIAKNNAVM 312
            ..||....:...:..::||:|:..:|:      .:|:...     :...|..|||..:|.....:
  Rat   238 LNMGQRCSDTRGITFEDVRVPKENVLI------GEGAGFK-----IAMGAFDRTRPTVAAGAVGL 291

  Fly   313 LASAATIATRYSAVRRQSPINPNEREPQIMDHVTQQMKLFPEIATSVAYRKAGDYLWNLYDVTIE 377
            ...|...||:|:..|:  .......|.|.:..:..:|.:..|:| .::|::|.   |        
  Rat   292 AQRALDEATKYALDRK--TFGKLLVEHQGVSFLLAEMAMKVELA-RLSYQRAA---W-------- 342

  Fly   378 DIENGKYERLPELHSLSCALKVTCSMDSASGVEKLRLACGGHGFLTSSNMSSIYVSATAACTYEG 442
            ::::|:  |.....|::.|.....:...|:...::   .||:||.|...:..:...|.....|||
  Rat   343 EVDSGR--RNTYFASIAKAFAGDIANQLATDAVQI---FGGYGFNTEYPVEKLMRDAKIYQIYEG 402

  Fly   443 ENTVLLLQIGR 453
            ...:..|.|.|
  Rat   403 TAQIQRLIIAR 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 75/336 (22%)
PLN02443 16..677 CDD:178062 75/336 (22%)
AcadmNP_058682.2 CaiA 39..420 CDD:224871 75/336 (22%)
MCAD 41..418 CDD:173846 75/336 (22%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 278..281 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.