DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acox57D-p and acdh-7

DIOPT Version :9

Sequence 1:NP_001286677.1 Gene:Acox57D-p / 37445 FlyBaseID:FBgn0034628 Length:677 Species:Drosophila melanogaster
Sequence 2:NP_510789.1 Gene:acdh-7 / 181758 WormBaseID:WBGene00020812 Length:412 Species:Caenorhabditis elegans


Alignment Length:320 Identity:70/320 - (21%)
Similarity:124/320 - (38%) Gaps:62/320 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 TYAQTELGHGTYLRGLETRADFDRKTDQFVLNTPNISSYKWWPGGLGHSSNHCLVMAQLYIDGDC 219
            :||.||.|.|:.:.|::|:.  ::|.|:::||     ..|.|....|| :|...|:|:...|...
 Worm   144 SYAVTEPGAGSDVAGVKTKC--EKKGDEYILN-----GSKMWITNAGH-ANWFFVLARSDPDPKT 200

  Fly   220 KGPHMFFIQVRDEDTHEPLPGVHIGDIGKKMGFIGVNNGFLGLKNVRIPRTRMLMRHAQVKADGS 284
            .....|...|.:.||    ||:..|.....||....:...:..::||:|...::    ....:|.
 Worm   201 AAGKAFTAFVVEGDT----PGLTRGRKEINMGQRCSDTRGITFEDVRVPAANVV----GAPGEGF 257

  Fly   285 YVSSPTNVLTYFAMVRTRCVIAKNNAVMLASAATIATRYSAVRRQSPINPNEREPQIMDH----- 344
            .|:..|       ..:||..:|.....:......:||:||..|:..       ..||.:|     
 Worm   258 KVAMKT-------FDKTRPTVAALATGVAYRCLDVATQYSLERKAF-------GTQIANHQGVSF 308

  Fly   345 VTQQMKLFPEIATSVAYRKAGDYLWNLYDVTIEDIENGK----YERLPELHSLSCALKVTCSMDS 405
            :..:|.:..|:|..:.|:...            :::.|:    |..:.:|.:..     |.:..:
 Worm   309 LLAEMAINCELARLMTYKSGA------------EVDAGRPGSYYASIAKLFASD-----TANQAA 356

  Fly   406 ASGVEKLRLACGGHGFLTSSNMSSIYVSATAACTYEGENTVLLLQIGRFLMKTWRAALTG 465
            .:.|:    ..||.||.|......:...|.....|||.:.:..:.|.|.|:.  |.|..|
 Worm   357 TNAVQ----IFGGAGFNTEYPAEKLMRDAKIFQIYEGTSQIQRMVIARQLLA--RVAQNG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acox57D-pNP_001286677.1 ACAD 14..653 CDD:299127 70/320 (22%)
PLN02443 16..677 CDD:178062 70/320 (22%)
acdh-7NP_510789.1 CaiA 24..408 CDD:224871 68/316 (22%)
ACAD 28..405 CDD:299127 67/313 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.