DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEFSec and TUF1

DIOPT Version :9

Sequence 1:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_014830.1 Gene:TUF1 / 854359 SGDID:S000005713 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:380 Identity:109/380 - (28%)
Similarity:176/380 - (46%) Gaps:67/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NIGLLGHVDSGKTTLAKALSSISST---------AAFDKNPQSVERGITLDLGFSGLLVDAPAHL 61
            |||.:||||.|||||..|::...:.         ||.||.|:...||||:          :.||:
Yeast    50 NIGTIGHVDHGKTTLTAAITKTLAAKGGANFLDYAAIDKAPEERARGITI----------STAHV 104

  Fly    62 P-QGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIG-ELLQKKLIV 124
            . :..:..::.|||||||..|:.:|.||..:|..::||.|..|:..||.|.|::. ::..:.::|
Yeast   105 EYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVV 169

  Fly   125 VINKIDVYPENQRASKLEKLRLRLAKTLEATTF-GGQVPI---CAVSALQGTH-------IAELR 178
            .:||:|...:.:   .||.:.:.:.:.|....| |...||   .|:.||:|..       |.:|.
Yeast   170 FVNKVDTIDDPE---MLELVEMEMRELLNEYGFDGDNAPIIMGSALCALEGRQPEIGEQAIMKLL 231

  Fly   179 EVLREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGE-----QRK 238
            :.:.|....|:|:|..|..|.|:..|.|.|:|||.||.:.:|.::...  ||..:|.     :..
Yeast   232 DAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGE--ELEIVGHNSTPLKTT 294

  Fly   239 VKSIQMFRKNVTSASMGDRIGLCVTQFNAKLLERG-IITQPGYLKPIYAVCLQFKPIRYYKEVIK 302
            |..|:||||.:.||..||..|:.:.......|:|| ::.:||.:|.             :.:::.
Yeast   295 VTGIEMFRKELDSAMAGDNAGVLLRGIRRDQLKRGMVLAKPGTVKA-------------HTKILA 346

  Fly   303 SMRKM-------HISVGHNTVMANVTLFRDTDGTTSTFQLDKEYE-YMEDVQPAE 349
            |:..:       |...|.|   ....:|..|...|...:..||.| :...|.|.:
Yeast   347 SLYILSKEEGGRHSGFGEN---YRPQMFIRTADVTVVMRFPKEVEDHSMQVMPGD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 64/207 (31%)
SelB 6..467 CDD:225815 109/380 (29%)
SelB_II 196..278 CDD:293897 28/87 (32%)
eSelB_III 283..396 CDD:294009 12/75 (16%)
TUF1NP_014830.1 PRK00049 40..437 CDD:234596 109/380 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.