DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEFSec and eEF1alpha2

DIOPT Version :9

Sequence 1:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_524611.1 Gene:eEF1alpha2 / 43736 FlyBaseID:FBgn0000557 Length:462 Species:Drosophila melanogaster


Alignment Length:329 Identity:81/329 - (24%)
Similarity:129/329 - (39%) Gaps:65/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INFNIGLLGHVDSGKTTLAKAL------------------------SSISSTAAFDKNPQSVERG 43
            |:.||.::|||||||:|....|                        .|.......||.....|||
  Fly     6 IHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERG 70

  Fly    44 ITLDLGFSGLLVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG----- 103
            ||:|:.....         :..:...|.:|.|||...|:.:|.|....|..:|:|.|..|     
  Fly    71 ITIDIALWKF---------ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 126

  Fly   104 --KQTQTAE-CLIIGELLQKKLIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPIC 164
              |..||.| .|:...|..|:|||.:||:|........::.|:::..::..::...:. ..|...
  Fly   127 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFV 191

  Fly   165 AVSALQGTHIAELREVL-----------------------REAYFQPQRNLADPLFMYVDHCFGI 206
            .:|...|.::.|..|.:                       .:|...|||....||.:.:...:.|
  Fly   192 PISGWHGDNMLEPSEKMPWFKGWSVERKEGKAEGKCLIDALDAILPPQRPTDKPLRLPLQDVYKI 256

  Fly   207 KGQGTVCTGTLLQGKVQVNNVIELPALGEQRKVKSIQMFRKNVTSASMGDRIGLCVTQFNAKLLE 271
            .|.|||..|.:..|.::...|:....:....:|||::|..:.:|.|..||.:|..|...:.|.|.
  Fly   257 GGIGTVPVGRVETGLLKPGMVVNFAPVNLVTEVKSVEMHHEALTEAMPGDNVGFNVKNVSVKELR 321

  Fly   272 RGII 275
            ||.:
  Fly   322 RGYV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 56/242 (23%)
SelB 6..467 CDD:225815 80/326 (25%)
SelB_II 196..278 CDD:293897 23/80 (29%)
eSelB_III 283..396 CDD:294009
eEF1alpha2NP_524611.1 PTZ00141 1..450 CDD:185474 81/329 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464620
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.