DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEFSec and CG2017

DIOPT Version :9

Sequence 1:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_649603.3 Gene:CG2017 / 40733 FlyBaseID:FBgn0037391 Length:643 Species:Drosophila melanogaster


Alignment Length:281 Identity:66/281 - (23%)
Similarity:103/281 - (36%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 INFNIGLLGHVDSGKTTLAKALSSIS-------STAAFDKNPQSVERGITL-----DLGFSGL-- 53
            |...:.:||..|:||:||...|:...       :.....::...::.|.|.     .|||..|  
  Fly   214 IEVRVAVLGGADAGKSTLLGVLTQDELDNGHGRARLNMFRHMHEIQSGRTSCISHETLGFDALGN 278

  Fly    54 --------LVDAPAHLPQGEQLQFTFVDCPGHASLIRTIIGGAQIID-----LMLLVVDAQKGKQ 105
                    ::.|.....:..:| .||:|..||...:||.:   |.:.     ..:|||.|..|..
  Fly   279 VVNYKYNEMMTAEEISDRSSKL-VTFMDLAGHRRYMRTTV---QALSGYSPHYAMLVVSAGSGCN 339

  Fly   106 TQTAECLIIGELLQKKLIVVINKIDVYPENQRASKL---------EKLRLRLAKTLEATTFGGQ- 160
            ..|.|.|.|...|.....|::.|.|:...:....:|         .|:...:..|.||.:.|.. 
  Fly   340 DTTEEHLAIVRALDMPFFVLVTKTDITSPDATVQELCNLLTTIGCRKVPFVVTNTDEAISAGSNQ 404

  Fly   161 -----VPICAVSALQGTHIAELREVLREAYF--------QPQRNLADPLFMYVDHCFGIKGQGTV 212
                 |||..||.:.||   .|..|.:..|.        :..|...:.....||..|.:...|.|
  Fly   405 ISENIVPIFCVSNVTGT---GLNLVTKFLYVLSPGISNAEKDRLEQESCEFQVDEIFRVSDVGPV 466

  Fly   213 CTGTLLQGKVQVNNVIELPAL 233
            ..|.|:||.:..|..:::..|
  Fly   467 VGGLLVQGVLTENMAMKIGPL 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 54/236 (23%)
SelB 6..467 CDD:225815 65/278 (23%)
SelB_II 196..278 CDD:293897 11/38 (29%)
eSelB_III 283..396 CDD:294009
CG2017NP_649603.3 GTPBP1 100..635 CDD:227583 66/281 (23%)
GTPBP1_like 217..436 CDD:206728 53/225 (24%)
GTPBP_II 450..536 CDD:293895 11/38 (29%)
GTPBP_III 547..634 CDD:294007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43721
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.