DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEFSec and CG33158

DIOPT Version :9

Sequence 1:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster


Alignment Length:432 Identity:101/432 - (23%)
Similarity:146/432 - (33%) Gaps:122/432 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NIGLLGHVDSGKTTLAKALSS----ISSTAA-----FDKNPQSVERGITLDLGFSGLLVDAPAHL 61
            ||.:|.|||.||||||.:|.:    ||...|     .|......|||||:......|.......:
  Fly    21 NICILAHVDHGKTTLADSLVASNGIISQRMAGKLRYLDNRSDEQERGITMKSSSISLYYQEAEEM 85

  Fly    62 PQGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECL--IIGELLQKKLIV 124
            ..........:|.|||......:....::.|..::|||..:|...||..||  |..|  |.|.::
  Fly    86 AGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEGVGPQTRACLRQIYEE--QLKPVL 148

  Fly   125 VINKIDVYPENQRASKLEKLRLRLAKTLEATTFGGQVPIC----AVSALQGTHIAE--------- 176
            |:||:|              ||.|.|.::  .......:|    .|:|:.|:..|.         
  Fly   149 VLNKLD--------------RLILEKQMD--PLDAYFHLCQVLEQVNAVLGSIFASDILAKEDIT 197

  Fly   177 --------LREV-LREAYFQPQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVI---- 228
                    |.|| ..|.||.|..........|....|.::....:....|...:..:.||:    
  Fly   198 KKDNYESALEEVDDSELYFSPSSGNVIFCSAYDGWAFSVRDFAAMYAKRLEMSRKDLENVLWGDF 262

  Fly   229 --------ELPALGEQRKVKS---IQMFRKNVTS--------------ASMGDRIGLCVTQFNAK 268
                    .||  |.|.|.|.   :|...:|:.|              ..:.:::||       |
  Fly   263 YYNSKKKEALP--GAQEKAKKPMFVQFVLENIWSLYDIIAIRKDKDKLPGIAEKLGL-------K 318

  Fly   269 LLERGI-ITQPGYLKPIYAVCLQFKPIRYYKEVIKSMRKMHISVGHN---------TVMANVTL- 322
            |..|.: :|.|..  .|.||..|:.||.  |.|: .|...|:...|.         ...|||.| 
  Fly   319 LATRDLRLTDPKL--QIKAVLGQWLPID--KSVL-HMVIQHVPPPHKISDERAQRLLYPANVDLS 378

  Fly   323 ------------FRDTDGTTSTFQLDKEYEYMEDVQPAEVQH 352
                        |...|..:|..     ..::..:.|..:.|
  Fly   379 SLPPETLELKESFTSCDANSSNV-----IAFVSKMTPVHITH 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 60/218 (28%)
SelB 6..467 CDD:225815 101/432 (23%)
SelB_II 196..278 CDD:293897 20/111 (18%)
eSelB_III 283..396 CDD:294009 20/92 (22%)
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 101/432 (23%)
EF2 20..249 CDD:206672 63/245 (26%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.