DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and Tm2d1

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_444387.1 Gene:Tm2d1 / 94043 MGIID:2137022 Length:208 Species:Mus musculus


Alignment Length:159 Identity:68/159 - (42%)
Similarity:98/159 - (61%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CNELQMMGQFMCPDPARGQIDPKTQQLAGCTREGRARVWCIAANEINCTE-TGNAT--------F 78
            |.:|: :||::|.:|   :|:..||:...||.. .|.|.|..|.:|.|.: :||.|        |
Mouse    49 CEDLR-VGQYICKEP---KINDATQEPVNCTNY-TAHVQCFPAPKITCKDLSGNETHFTGSEVGF 108

  Fly    79 TREVPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQV 143
            .:.:.|:..|||.....:.||:|||..|.||||||||.:|||||||:|...:|.|||.:||::|:
Mouse   109 LKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQI 173

  Fly   144 VGPADGSAYVIPYYGAGIHIVRSDNTTYR 172
            |||:|||:|:|.|||..:..:...|.|:|
Mouse   174 VGPSDGSSYIIDYYGTRLTRLSITNETFR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 26/42 (62%)
Tm2d1NP_444387.1 TM2 118..167 CDD:282945 29/48 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831192
Domainoid 1 1.000 60 1.000 Domainoid score I10585
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12928
Inparanoid 1 1.050 129 1.000 Inparanoid score I4642
Isobase 1 0.950 - 0 Normalized mean entropy S5008
OMA 1 1.010 - - QHG52603
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007028
OrthoInspector 1 1.000 - - oto94146
orthoMCL 1 0.900 - - OOG6_106914
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2848
SonicParanoid 1 1.000 - - X5123
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.