DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and TM2D2

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_510882.1 Gene:TM2D2 / 83877 HGNCID:24127 Length:214 Species:Homo sapiens


Alignment Length:158 Identity:54/158 - (34%)
Similarity:77/158 - (48%) Gaps:24/158 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ETHQINVDCNELQMMGQFM-CPDPARGQID-----PKTQQLA-GCTREG--------RARVWCIA 64
            :.|...:.|:.|.  .:|: |.||    :|     ..:|:|. ||.:.|        ...|.|.|
Human    65 DPHSPVILCSYLP--DEFIECEDP----VDHVGNATASQELGYGCLKFGGQAYSDVEHTSVQCHA 123

  Fly    65 ANEINCTETGNATFTRE-VPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGM 128
            .:.|.|...  .||.|| .||....|::..||||.|.|||.||||||.||:.|..:.|..||||:
Human   124 LDGIECASP--RTFLRENKPCIKYTGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGL 186

  Fly   129 FLGQLIDIVLIALQVVGPADGSAYVIPY 156
            .:...:|::|:....:.|:|||.:...|
Human   187 GIWWFVDLILLITGGLMPSDGSNWCTVY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 23/42 (55%)
TM2D2NP_510882.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..59
TM2 146..195 CDD:377473 24/48 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.