DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and tm2d2

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001011324.1 Gene:tm2d2 / 496785 XenbaseID:XB-GENE-964283 Length:198 Species:Xenopus tropicalis


Alignment Length:134 Identity:47/134 - (35%)
Similarity:65/134 - (48%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CPDPARGQIDPKTQQ--LAGCTREG--------RARVWCIAANEINCTETGNATFTR-EVPCKWT 87
            |.||.....:...||  ..||.:.|        ..:|.|.|.:.|.|  .|..:|.| ..||...
 Frog    67 CDDPVDHMGNGTAQQELRYGCKKFGGQAYGDVEHTQVMCRALDGIEC--DGPRSFLRGNKPCIKY 129

  Fly    88 NGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQVVGPADGSAY 152
            .|::..||||.|.|||.||||||.||:.|..:.|..||||:.:...:|::|:....:.|:|.|.:
 Frog   130 TGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDNSNW 194

  Fly   153 VIPY 156
            ...|
 Frog   195 CTIY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 23/42 (55%)
tm2d2NP_001011324.1 TM2 130..179 CDD:377473 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.