DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and amx

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001245591.1 Gene:amx / 43869 FlyBaseID:FBgn0000077 Length:284 Species:Drosophila melanogaster


Alignment Length:157 Identity:53/157 - (33%)
Similarity:78/157 - (49%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INVDC---NELQMMGQFMCPDPARGQIDPKTQQLAGCTREGRARVW---------CIAANE---- 67
            :||.|   |.:|.:|            :...|:...|....:..:|         |.:|.:    
  Fly   140 LNVTCEVINNVQCLG------------ERSFQRQMNCRYCYQTEMWQQSCGQRSSCNSATDKLFR 192

  Fly    68 INCTE------TGNATFTREVPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLG 126
            .|||.      .||.:|||.:.|.||.||...|.||:|:.||.||.||||||:...|:.|..:.|
  Fly   193 TNCTVHHDVLCLGNRSFTRNLRCNWTQGYRWSTALLISLTLGGFGADRFYLGHWQEGIGKLFSFG 257

  Fly   127 GMFLGQLIDIVLIALQVVGPADGSAYV 153
            |:.:..:||::||::..:||||||.|:
  Fly   258 GLGVWTIIDVLLISMHYLGPADGSLYI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 20/42 (48%)
amxNP_001245591.1 TM2 219..268 CDD:282945 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442266
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5008
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21016
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.