DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and tm2d2

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001002640.1 Gene:tm2d2 / 436913 ZFINID:ZDB-GENE-040718-387 Length:229 Species:Danio rerio


Alignment Length:134 Identity:46/134 - (34%)
Similarity:64/134 - (47%) Gaps:13/134 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CPDPA--RGQIDPKTQQLAGCTREG--------RARVWCIAANEINCTETGNATFTR-EVPCKWT 87
            |.||.  .|.:....:...||.:.|        ..:|.|.|.:.|.|  .|...|.| ..||...
Zfish    98 CQDPVDHGGNVSAFQELGYGCVKFGGQVYKDVNHTQVLCTALDGIEC--AGPREFLRGNEPCIKY 160

  Fly    88 NGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQVVGPADGSAY 152
            .|::..||||.|.|||.||||||.||:.|..:.|..||||:.:...:|::|:....:.|:|.|.:
Zfish   161 TGHYFITTLLYSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLTPSDSSNW 225

  Fly   153 VIPY 156
            ...|
Zfish   226 CTFY 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 23/42 (55%)
tm2d2NP_001002640.1 TM2 161..210 CDD:282945 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.