DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and C41D11.9

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_491372.1 Gene:C41D11.9 / 266651 WormBaseID:WBGene00016567 Length:195 Species:Caenorhabditis elegans


Alignment Length:131 Identity:47/131 - (35%)
Similarity:70/131 - (53%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CNELQMMGQFMCPDPARGQIDPKTQQLAGCTREGRARVWCIAANEINCTETGNATFTREVPCKWT 87
            |.:| :.|.:.| :||.......|:.|.  |:       |.|.:.:.|  .|...|.:.:||.|:
 Worm    78 CWQL-LPGDYDC-EPATNCSTSSTKLLV--TK-------CSAHSSVIC--MGQRNFYKRIPCNWS 129

  Fly    88 NGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQVVGPADGSAY 152
            :||....|::|||.||.||.||||||.....:.|..:.||:.:..|:|:||||:..:.|.|||.|
 Worm   130 SGYSWTKTMILSVVLGGFGADRFYLGLWKSAIGKLFSFGGLGVWTLVDVVLIAVGYIKPYDGSMY 194

  Fly   153 V 153
            :
 Worm   195 I 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 19/42 (45%)
C41D11.9NP_491372.1 TM2 130..179 CDD:282945 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.