DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and tm2d1

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:XP_004914000.1 Gene:tm2d1 / 100494081 XenbaseID:XB-GENE-970681 Length:192 Species:Xenopus tropicalis


Alignment Length:161 Identity:73/161 - (45%)
Similarity:99/161 - (61%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VDCNELQMMGQFMCPDPARGQIDPKTQQLAGCTREGRARVWCIAANEINC-TETGNAT------- 77
            |.|:||: :|||:|.||   :|:|.||:...|:.. .|...|..|..|.| ...||.|       
 Frog    31 VKCDELR-LGQFICVDP---EINPATQEPVNCSNY-TADAPCFPAPNITCKVYGGNVTTFTGKEI 90

  Fly    78 -FTREVPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIAL 141
             |.|..||:..|||.....:.||:|||..|.||||||||.:|:|||||:|...:|.|:|.:||::
 Frog    91 GFYRPFPCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGMLKFCTVGFCGIGSLLDFILISM 155

  Fly   142 QVVGPADGSAYVIPYYGAGIHIVRSDNTTYR 172
            |:|||:|||:|:|.||||.:..:..:|.|||
 Frog   156 QIVGPSDGSSYIIDYYGARLVHLSINNETYR 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 24/42 (57%)
tm2d1XP_004914000.1 TM2 102..151 CDD:377473 27/48 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10542
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12928
Inparanoid 1 1.050 136 1.000 Inparanoid score I4447
OMA 1 1.010 - - QHG52603
OrthoDB 1 1.010 - - D1467308at2759
OrthoFinder 1 1.000 - - FOG0007028
OrthoInspector 1 1.000 - - oto104353
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.