DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10795 and tm2d1

DIOPT Version :9

Sequence 1:NP_001356967.1 Gene:CG10795 / 37443 FlyBaseID:FBgn0034626 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001092733.1 Gene:tm2d1 / 100093710 ZFINID:ZDB-GENE-050208-580 Length:197 Species:Danio rerio


Alignment Length:181 Identity:74/181 - (40%)
Similarity:106/181 - (58%) Gaps:19/181 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLLLFFFAKETHQINVD---CNELQMMGQFMCPDPARGQIDPKTQQLAGCTREGRARVWCIAAN 66
            ||||..|.....|.:..|   |::|. :||::|.:|   :||..||:...| ::..|.|.|:.|.
Zfish    17 LLLLFTFCLTVIHSLGNDVDSCDKLH-LGQYLCKEP---RIDDATQEPETC-KDRVAWVECLPAP 76

  Fly    67 EINCTETGNAT----------FTREVPCKWTNGYHLDTTLLLSVFLGMFGVDRFYLGYPGIGLLK 121
            .|:| ...|.|          |.:.:||:..:||.....:.||:|||..|.||||||||.:||||
Zfish    77 NISC-RLSNGTQFKFSGEEVGFNKTIPCRNVSGYSYKVAVALSLFLGWIGADRFYLGYPALGLLK 140

  Fly   122 FCTLGGMFLGQLIDIVLIALQVVGPADGSAYVIPYYGAGIHIVRSDNTTYR 172
            |||:|...:|.|:|.:||::|:|||:|||.|::.||||.:..:...|.|||
Zfish   141 FCTVGFCGIGSLVDFMLISMQIVGPSDGSDYIVDYYGARLTRLSITNETYR 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10795NP_001356967.1 TM2 94..137 CDD:310034 25/42 (60%)
tm2d1NP_001092733.1 TM2 107..155 CDD:282945 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574154
Domainoid 1 1.000 59 1.000 Domainoid score I10682
eggNOG 1 0.900 - - E1_KOG4272
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12928
Inparanoid 1 1.050 131 1.000 Inparanoid score I4614
OMA 1 1.010 - - QHG52603
OrthoDB 1 1.010 - - D1467308at2759
OrthoFinder 1 1.000 - - FOG0007028
OrthoInspector 1 1.000 - - oto39953
orthoMCL 1 0.900 - - OOG6_106914
Panther 1 1.100 - - LDO PTHR21016
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2848
SonicParanoid 1 1.000 - - X5123
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.