DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and PRY3

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:172 Identity:38/172 - (22%)
Similarity:56/172 - (32%) Gaps:56/172 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHN 120
            |......::|.|:.|||   |.||        ....|.:.|.|.|...:....     |..||..
Yeast    19 QTTFPNFESDVLNEHNK---FRAL--------HVDTAPLTWSDTLATYAQNYA-----DQYDCSG 67

  Fly   121 TYRYANS--GQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIF-EDYGHF 182
            ...:::.  |:||...:..       |..|:    .|:.|....:.|       .|.| |..|||
Yeast    68 VLTHSDGPYGENLALGYTD-------TGAVD----AWYGEISKYNYS-------NPGFSESTGHF 114

  Fly   183 AELSVDKNFAVGCSIMRFTRPDYPSVYIY------NFI-CNY 217
            .::.......:||.            |.|      |:| |:|
Yeast   115 TQVVWKSTAEIGCG------------YKYCGTTWNNYIVCSY 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/165 (22%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 37/167 (22%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.