DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and PRY1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:45/189 - (23%)
Similarity:62/189 - (32%) Gaps:56/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDEL--- 100
            |..||..........:...|:|...:..|..|||:|   ||.|..   ||     :.|.|.|   
Yeast   139 ATTTTSQAAATSSASSSDSDLSDFASSVLAEHNKKR---ALHKDT---PA-----LSWSDTLASY 192

  Fly   101 --QYLSMLNTRTCKLDHDDCHNTYRYANS--GQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDL 161
              .|          .|:.||..|..::..  |:||...:...:           .:..|:||...
Yeast   193 AQDY----------ADNYDCSGTLTHSGGPYGENLALGYDGPA-----------AVDAWYNEISN 236

  Fly   162 IDSSFIDSFKVTPIF-EDYGHFAELSVDKNFAVGCSIMRF--TRPDYPSVYIYNFICNY 217
            .|.|       .|.| .:.|||.::.......|||.|...  ...||       .||:|
Yeast   237 YDFS-------NPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDY-------VICSY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 40/165 (24%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344537
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.