DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT1G50060

DIOPT Version :10

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:167 Identity:36/167 - (21%)
Similarity:61/167 - (36%) Gaps:56/167 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQ 129
            |:|::||..|   |...||         .:|||..|...::..:...|.|.:..|:...|   |:
plant    29 DYLNSHNTAR---AQVGVP---------NVVWDTTLAAYALNYSNFRKADCNLVHSNGPY---GE 78

  Fly   130 NLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYG-----------HFA 183
            ||.   :..|...:..|.|:    ||.:|              .|.: .|.           |:.
plant    79 NLA---KGSSSSFSAISAVK----LWVDE--------------KPYY-SYAYNNCTGGKQCLHYT 121

  Fly   184 ELSVDKNFAVGCSIMRFTRPDYPSVYIYNFI-CNYAS 219
            ::....:..:||:.::.|.       .:.|: |||.|
plant   122 QVVWRDSVKIGCARVQCTN-------TWWFVSCNYNS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399 34/164 (21%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 36/167 (22%)

Return to query results.
Submit another query.