DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT1G01310

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:167 Identity:36/167 - (21%)
Similarity:59/167 - (35%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYL--SMLNTRTCKLDHDDCHNT 121
            |:|...:||.|||..|  ..:|:.|          ..||..|...  :..|.|.     .||...
plant    81 VNRASREFLIAHNLVR--ARVGEPP----------FQWDGRLAAYARTWANQRV-----GDCRLV 128

  Fly   122 YRYANSGQNLCAV----WRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDY--G 180
            :.....|:|:...    |.||           :.:.:|.:|     ..|.| .|.......:  |
plant   129 HSNGPYGENIFWAGKNNWSPR-----------DIVNVWADE-----DKFYD-VKGNTCEPQHMCG 176

  Fly   181 HFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY 217
            |:.::....:..|||:.:..:.....::.:||...||
plant   177 HYTQIVWRDSTKVGCASVDCSNGGVYAICVYNPPGNY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 34/163 (21%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 34/161 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.