DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT1G01310

DIOPT Version :10

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:167 Identity:36/167 - (21%)
Similarity:59/167 - (35%) Gaps:42/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYL--SMLNTRTCKLDHDDCHNT 121
            |:|...:||.|||..|  ..:|:.|          ..||..|...  :..|.|.     .||...
plant    81 VNRASREFLIAHNLVR--ARVGEPP----------FQWDGRLAAYARTWANQRV-----GDCRLV 128

  Fly   122 YRYANSGQNLCAV----WRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDY--G 180
            :.....|:|:...    |.||           :.:.:|.:|     ..|.| .|.......:  |
plant   129 HSNGPYGENIFWAGKNNWSPR-----------DIVNVWADE-----DKFYD-VKGNTCEPQHMCG 176

  Fly   181 HFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY 217
            |:.::....:..|||:.:..:.....::.:||...||
plant   177 HYTQIVWRDSTKVGCASVDCSNGGVYAICVYNPPGNY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399 34/163 (21%)
AT1G01310NP_171638.2 CAP_PR-1 87..219 CDD:349400 34/161 (21%)

Return to query results.
Submit another query.