DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crispld1

DIOPT Version :10

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_113579.2 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:188 Identity:49/188 - (26%)
Similarity:75/188 - (39%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKVPGYYP-AARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            |..|||.|:.:        || |:.|..|.||.||:..:......|..:|....   ...:.|||
Mouse    66 LDLHNKLRSQV--------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPAS---LLPSIGQN 119

  Fly   131 LCAVW---RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPI--FEDYG----HFAELS 186
            |.|.|   ||.:.||..          |::|  :.|.|:....:..|.  |...|    |:.::.
Mouse   120 LGAHWGRYRPPTFHVQA----------WYDE--VRDFSYPYENECDPYCPFRCSGPVCTHYTQVV 172

  Fly   187 VDKNFAVGCSI-----MRFTRPDYP-SVYIYNFICNYASL-YALGAPVYETGRAASRC 237
            ...:..:||::     |......:| :||:   :|||:.. ...|...|:.||..|.|
Mouse   173 WATSSRIGCAVNLCHNMNIWGQIWPKAVYL---VCNYSPKGNWWGHAPYKHGRPCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399 42/166 (25%)
Crispld1NP_113579.2 CAP_CRISPLD1 62..207 CDD:349407 42/166 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.