DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crispld1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:188 Identity:49/188 - (26%)
Similarity:75/188 - (39%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKVPGYYP-AARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            |..|||.|:.:        || |:.|..|.||.||:..:......|..:|....   ...:.|||
Mouse    66 LDLHNKLRSQV--------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPAS---LLPSIGQN 119

  Fly   131 LCAVW---RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPI--FEDYG----HFAELS 186
            |.|.|   ||.:.||..          |::|  :.|.|:....:..|.  |...|    |:.::.
Mouse   120 LGAHWGRYRPPTFHVQA----------WYDE--VRDFSYPYENECDPYCPFRCSGPVCTHYTQVV 172

  Fly   187 VDKNFAVGCSI-----MRFTRPDYP-SVYIYNFICNYASL-YALGAPVYETGRAASRC 237
            ...:..:||::     |......:| :||:   :|||:.. ...|...|:.||..|.|
Mouse   173 WATSSRIGCAVNLCHNMNIWGQIWPKAVYL---VCNYSPKGNWWGHAPYKHGRPCSAC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 42/166 (25%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 42/166 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.