DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CRISPLD1

DIOPT Version :10

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:209 Identity:54/209 - (25%)
Similarity:81/209 - (38%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNKRRNFLALGKVPGYYP-AARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            |..|||.|:.:        || |:.|..|.||.||:..:.....:|..:|....   ...:.|||
Human    66 LDLHNKLRSQV--------YPTASNMEYMTWDVELERSAESWAESCLWEHGPAS---LLPSIGQN 119

  Fly   131 LCAVW-RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPI--FEDYG----HFAELSVD 188
            |.|.| |.|.|..:|.|        |::|  :.|.|:....:..|.  |...|    |:.::...
Human   120 LGAHWGRYRPPTFHVQS--------WYDE--VKDFSYPYEHECNPYCPFRCSGPVCTHYTQVVWA 174

  Fly   189 KNFAVGCSI-----MRFTRPDYP-SVYIYNFICNYASL-YALGAPVYETGRAASRC--------- 237
            .:..:||:|     |......:| :||:   :|||:.. ...|...|:.||..|.|         
Human   175 TSNRIGCAINLCHNMNIWGQIWPKAVYL---VCNYSPKGNWWGHAPYKHGRPCSACPPSFGGGCR 236

  Fly   238 -----TTGKSHFYP 246
                 ..|...:||
Human   237 ENLCYKEGSDRYYP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399 44/164 (27%)
CRISPLD1NP_113649.1 CAP_CRISPLD1 62..207 CDD:349407 44/164 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 394..491 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.