DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT4G30320

DIOPT Version :10

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:50 Identity:11/50 - (22%)
Similarity:19/50 - (38%) Gaps:16/50 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKDYSW----CDPDLCGN------------GVRHIACRTTGNFHRRCQPD 53
            |:.|::    |:.::||:            |..|:.|...|.....|..|
plant   101 ARSYNYRSNSCNSEMCGHYTQIVWKNTQKIGCAHVICNGGGGVFLTCNYD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 CAP_euk 63..218 CDD:349399
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.