DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT3G19690

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:166 Identity:37/166 - (22%)
Similarity:60/166 - (36%) Gaps:59/166 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            ||.|||:.||.:.|.            .:|||||:...:.                 .|||...|
plant    29 FLEAHNEARNEVGLD------------PLVWDDEVAAYAA-----------------SYANQRIN 64

  Fly   131 LCAVWRPRSP---HVNVTS---LVEECLGLWFNE---FDLIDSSFIDSFKVTPIFEDYGHFAELS 186
            .||:.....|   ::.::|   ..|:...:|.||   :|...::..|....|.:     |:.::.
plant    65 DCALVHSNGPFGENIAMSSGEMSAEDAAEMWINEKQYYDYDSNTCNDPNGGTCL-----HYTQVV 124

  Fly   187 VDKNFAVGCSIMRFTRPDYPSVYIYN----FI-CNY 217
            ......:||:.:           :.|    || |||
plant   125 WKNTVRLGCAKV-----------VCNSGGTFITCNY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/166 (22%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 37/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.