DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and AT3G09590

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_187570.1 Gene:AT3G09590 / 820116 AraportID:AT3G09590 Length:186 Species:Arabidopsis thaliana


Alignment Length:211 Identity:45/211 - (21%)
Similarity:73/211 - (34%) Gaps:72/211 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPLICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQ-----VDVS 60
            :|.|..||.:..|:|.         ..|.:.|..:                ||||.     |:.:
plant     5 LSHPSSCLLLLFLLFS---------GHPSVLGTSI----------------PDAVNTAARLVNRA 44

  Fly    61 RH---KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTY 122
            |.   ..:||.|||..|            .::.:.|:.||.:   |:....:..|....||...:
plant    45 RRAKLSREFLQAHNDAR------------VSSGVPTLGWDRD---LARFADKWAKQRKSDCSMIH 94

  Fly   123 RYANSGQNLCAVWRPR----SPHVNVTSLVEECLGLWFNE---FDLIDSSFIDSFKVTPIFEDYG 180
            .....|:|:  .|..|    ||...||.        ||.|   :|:..::....       :..|
plant    95 SGGPYGENI--FWHRRKKTWSPEKVVTR--------WFEERFNYDVKTNTCAPG-------KMCG 142

  Fly   181 HFAELSVDKNFAVGCS 196
            |:.::...:..||||:
plant   143 HYTQMVWRETTAVGCA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 31/141 (22%)
AT3G09590NP_187570.1 CAP_PR-1 50..186 CDD:349400 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.