DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crispld2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:201 Identity:51/201 - (25%)
Similarity:82/201 - (40%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANS 127
            :.:.|..|||.|     |:|  |.||:.|..|.||:||:..:......|..:|....   ...:.
Mouse    56 RQEILMLHNKLR-----GQV--YPPASNMEHMTWDEELERSAAAWAHRCLWEHGPAG---LLRSI 110

  Fly   128 GQNLCAVW-RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED------YGHFAEL 185
            ||||...| |.|||..:|.|        |::|  :.|.::....:.||...:      ..|:.::
Mouse   111 GQNLAVHWGRYRSPGFHVQS--------WYDE--VKDYTYPYPHECTPRCRERCSGPMCTHYTQM 165

  Fly   186 SVDKNFAVGCSIMRFTRPDY------PSVYIYNFICNYASL-YALGAPVYETGRAASRCTTGKSH 243
            .......:||::......:.      .:||:   :|||:.. ..:|...|:.||..|.|.:.   
Mouse   166 VWATTNKIGCAVHTCRNMNVWGDTWENAVYL---VCNYSPKGNWIGEAPYKHGRPCSECPSS--- 224

  Fly   244 FYPGLC 249
             |.|.|
Mouse   225 -YGGGC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 41/167 (25%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 41/167 (25%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.