DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crisp4

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:208 Identity:47/208 - (22%)
Similarity:74/208 - (35%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTC-KLDHDDCHNTYRYANSG 128
            :.::.||..|.     ||..  ||..|..:.|.......:.:..|.| |.|.|...........|
Mouse    87 EIVNTHNAFRR-----KVSP--PARNMLKVSWSSAAAENARILARYCDKSDSDSLERRLPNTFCG 144

  Fly   129 QNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYG------------H 181
            :|:.....|.|    .:.::|    :||||     |.:   ||       ||            |
Mouse   145 ENMLMEHYPSS----WSKVIE----IWFNE-----SKY---FK-------YGEWPSTDDDIETDH 186

  Fly   182 FAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYA----SLYALGAPVYETGRAASRCTTGKS 242
            :.::.....:.|||.:.. .|....:.|:|  :|:|.    ....|..| |:.|   |.|....:
Mouse   187 YTQMVWASTYLVGCDVAA-CRRQKAATYLY--VCHYCHEGNHQDTLNMP-YKEG---SPCDDCPN 244

  Fly   243 HFYPGLCSTREVY 255
            :...|||:...:|
Mouse   245 NCEDGLCTNPCIY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 36/165 (22%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.