DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Pi16

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:184 Identity:45/184 - (24%)
Similarity:69/184 - (37%) Gaps:29/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANS 127
            |...:..||:.|..::    |   ||:.|..|.|||||...:....:.|...    ||..| ...
Mouse    35 KQTMVDLHNQYRAQVS----P---PASDMLQMRWDDELAAFAKAYAQKCVWG----HNKER-GRR 87

  Fly   128 GQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDL--IDSSFIDSFKVTPIFEDYGHFAELSVDKN 190
            |:||.|:       .:....|...:|.|..|.:.  ..::..|..::.      ||:.::...|.
Mouse    88 GENLFAI-------TDEGMDVPLAVGNWHEEHEYYNFSTATCDPNQMC------GHYTQVVWSKT 139

  Fly   191 FAVGC-SIMRFTRPDYPSVYIYNFICNYASL-YALGAPVYETGRAASRCTTGKS 242
            ..:|| |....|........|:..:|||... ...|...|:.|...|:|..|.|
Mouse   140 ERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCPLGYS 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/157 (24%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 37/157 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.