DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Glipr1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:199 Identity:42/199 - (21%)
Similarity:75/199 - (37%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSML 106
            ::.:|.....||....|..:   :.:..||:.|:     ||..  ||..|..|.||.:|..::..
Mouse    16 SSSSFTASTLPDITNEDFIK---ECVQVHNQLRS-----KVSP--PARNMLYMSWDPKLAQIAKA 70

  Fly   107 NTRTCKLDHD-DCHNTY--RYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFID 168
            .|::|:..|: ..|:..  .:...|:|   :|.......:|:|    .:..|:.|....|     
Mouse    71 WTKSCEFKHNPQLHSRIHPNFTALGEN---IWLGSLSIFSVSS----AISAWYEEIKHYD----- 123

  Fly   169 SFKVTPIFEDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETGRA 233
             |.........||:.::....::.:||::......       .||||:|..........|:.|..
Mouse   124 -FSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNG-------ANFICDYGPAGNYPTWPYKQGAT 180

  Fly   234 ASRC 237
            .|.|
Mouse   181 CSDC 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 33/157 (21%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 35/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.