DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:190 Identity:52/190 - (27%)
Similarity:80/190 - (42%) Gaps:31/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDC-HNTYR----YA 125
            ||:.||:.|.     ||..  |||.|..:.||.:|..|:...||.|||.|:.| ...|.    |.
Mouse    45 FLNIHNELRR-----KVQP--PAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYD 102

  Fly   126 NSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKN 190
            ..|:|   ::..|     :.:..|:.:..|:||     |.:. :|......|..||:.::...|.
Mouse   103 FIGEN---IYLGR-----IETQPEDVVINWYNE-----SKYF-NFDFNTCSEMCGHYTQVVWAKT 153

  Fly   191 FAVGCSIMRFTRPDYPSVYIYNFICNYASL-YALGAPVYETGRAASRCTTGKSHFYPGLC 249
            ..:||::...  |:........|:|||:.. ..:|...|..|.:.|.|  |:......||
Mouse   154 VKIGCAVSNC--PNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMC--GQKTCENSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 43/156 (28%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 44/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841390
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.