DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Crisp1

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:262 Identity:55/262 - (20%)
Similarity:89/262 - (33%) Gaps:65/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNK-RRN 75
            :||..|.||...:...|.:.   :||:      ...|......:....:..:.:.:..||. |||
  Rat     4 KLILLLFLAATLTVFVPVVT---LRHL------KLDRALYNQLITESQTEPQEEIVDTHNAFRRN 59

  Fly    76 FLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTC-KLDHDDCH----NTY--------RYANS 127
            ...        ||..|..|.|.......:.:..|.| |.|.|...    ||:        .|.:|
  Rat    60 VSP--------PARNMLKMSWSSAAAENARILARYCDKSDSDSLERRLPNTFCGENMHMENYPSS 116

  Fly   128 GQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFA 192
            ..|:..:|...|.:..        .|.|.:..|.|              |.| |:.::....::.
  Rat   117 WSNVIEIWYNESKYFK--------YGEWPSTDDDI--------------ETY-HYTQMVWASSYL 158

  Fly   193 VGCSIMRFTRPDYPSVYIYNFICNYA----SLYALGAPVYETGRAASRCTTGKSHFYPGLCSTRE 253
            :||.:.. .|....:.|:|  :|:|.    |...|..| |:.|.....|   .::...|||:...
  Rat   159 IGCDVAS-CRRQKAATYLY--VCHYCHEGNSQDTLNMP-YKEGPPCQDC---PNNCEDGLCTNPC 216

  Fly   254 VY 255
            :|
  Rat   217 LY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 35/168 (21%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 36/169 (21%)
Crisp 200..254 CDD:285731 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.