DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and crispld2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:224 Identity:56/224 - (25%)
Similarity:88/224 - (39%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYP-AARMATMVWDDELQYLSMLNTRT 110
            |.|.:...::.|    |.:.:..|||.|     |:|   :| |:.|..|.|||||:..:......
 Frog    45 HSRTRRAILRTD----KEEIIQLHNKLR-----GQV---HPSASNMEYMTWDDELEKSAEAWAEE 97

  Fly   111 CKLDHDDCHNTYRYANSGQNLCAVW-RPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTP 174
            |..:|..   |....:.||||...| |.|.|..:|.|        |::|  :.|.::....:..|
 Frog    98 CIWEHGP---TALLMSIGQNLAVHWGRYRQPAYHVQS--------WYDE--VKDYTYPYPHECNP 149

  Fly   175 IFED------YGHFAELSVDKNFAVGCSIMRFTRPDY------PSVYIYNFICNYASL-YALGAP 226
            ...:      ..|:.::.......|||::....|.:.      .:||:   :|||:.. ..:|..
 Frog   150 YCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVYL---VCNYSPKGNWIGEA 211

  Fly   227 VYETGRAASRCTTGKSHFYPGLCSTREVY 255
            .|:.||..|.|...    |.|.|.....|
 Frog   212 PYKNGRPCSECPPS----YGGNCQNNLCY 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 42/168 (25%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 42/168 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.