DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and crispl

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:211 Identity:52/211 - (24%)
Similarity:85/211 - (40%) Gaps:49/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AVQVDVSRHKADFLHAHNK-RRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHD- 116
            |:..|:..::...|:.||: |||        ...|.:.|..|||.|.....:.....:||..|. 
 Frog    99 ALSTDLESNRQSILNVHNELRRN--------ANPPPSNMLKMVWSDLAAKSAAKWANSCKQYHSL 155

  Fly   117 DCHNTYRYANSGQNLC-----AVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIF 176
            ....|....:.|:||.     |.|             |:.:..:::|        |:.|......
 Frog   156 KPERTIPGFSCGENLFMASYKASW-------------EDVIRAFYSE--------IEDFLYGKGA 199

  Fly   177 EDYG----HFAELSVDKNFAVGCSIMRFTRPDYPSVYIYNFICNYASL--YA-LGAPVYETGRAA 234
            ::.|    ||.::....::.|||:..:....|: |:..| |:|:||..  |. :|.| |:||:..
 Frog   200 KEVGLQILHFTQVMWFSSWLVGCAAAQCPITDH-SLEFY-FVCHYAPAGNYGNVGIP-YKTGKPC 261

  Fly   235 SRCTTGKSHFYPGLCS 250
            ..|   ||....|||:
 Frog   262 EDC---KSSCENGLCT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 36/165 (22%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 38/169 (22%)
Crisp 261..314 CDD:369954 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.