DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and r3hdml

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:271 Identity:58/271 - (21%)
Similarity:104/271 - (38%) Gaps:62/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHA 69
            |:|.   ||:|.:.|     |......|     |....:|....:.:..:::.:| |:.:|....
Zfish     3 LVCA---QLVFAVTL-----WTAGAEAG-----IVAVCSGTSLLQAEQLSMEAEV-RNSSDGSTF 53

  Fly    70 HNKRRNFLALGK----VPGYY---------PAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNT 121
            ..:||.|:: ||    :..|:         |||.|..||||:.|...:......|..:|...|  
Zfish    54 RVRRRRFIS-GKDMTALLDYHNRVRSQVFPPAANMEYMVWDERLAKSAEFWASQCIWEHGPHH-- 115

  Fly   122 YRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELS 186
             ...:.||||..:   ...:.::..||:.    |::|..........|..|..      |:.::.
Zfish   116 -FLQHIGQNLSII---SGRYKSIIDLVKS----WYDERHSFSYPSRCSGSVCT------HYTQMV 166

  Fly   187 VDKNFAVGCSIMRFTRPDYPSVYIYN--------FICNYA-SLYALGAPVYETGRAASRCTTGKS 242
            ...:..:||:|.:.:     .::::.        .:|||| ....:|...|:.||..|.|.:.  
Zfish   167 WAASNKIGCAIKKCS-----DIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACPSS-- 224

  Fly   243 HFYPGLCSTRE 253
              |.|.|:..:
Zfish   225 --YGGSCNKNQ 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 35/175 (20%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 29/155 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585751
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.