DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and pi15b

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:203 Identity:54/203 - (26%)
Similarity:77/203 - (37%) Gaps:51/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LHAHNK-RRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQN 130
            |..||| |.|.        :.|||.|..|:|||.|...:.....||..:|...: ..||.  |||
Zfish    70 LDYHNKVRANV--------FPPAANMEYMLWDDGLARSAEAWAATCIWEHGPPY-LLRYL--GQN 123

  Fly   131 LCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFED---------YG----HF 182
            |..   ....:.::..||:.    |::|  :.|..|       |...|         ||    |:
Zfish   124 LSV---RTGNYRSILQLVKP----WYDE--VRDYMF-------PYPRDCNPHCPMRCYGPMCTHY 172

  Fly   183 AELSVDKNFAVGCSIMR-FTRPDYPSVY---IYNFICNYASL-YALGAPVYETGRAASRCTTGKS 242
            .::....:..|||:|.. |....:.:|:   .| .:|||:.. ..:|...|..|...|.|...  
Zfish   173 TQMVWASSNRVGCAIQTCFNMVVWGAVWREATY-LVCNYSPKGNWIGEAPYRVGVPCSACPPS-- 234

  Fly   243 HFYPGLCS 250
              |.|.||
Zfish   235 --YGGSCS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 44/168 (26%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.