DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:193 Identity:53/193 - (27%)
Similarity:84/193 - (43%) Gaps:37/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 FLHAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHN-----TYRYA 125
            ||:.||:.|.     ||..  |||.|..::||.:|..|:...||.|||.|:.|.:     ...|.
Mouse    45 FLNIHNELRR-----KVQP--PAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYD 102

  Fly   126 NSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKN 190
            ..|:|:..        ..:.:..|:.:..|:||  ..|.:|:|: ..:.|..:|   .:|...|.
Mouse   103 FIGENIYL--------GEIETQPEDVVNNWYNE--NTDYNFVDN-TCSKICRNY---TQLVWAKT 153

  Fly   191 FAVGCSIMRFTRPDYPSVYIYN---FICNYASL-YALGAPVYETGRAASRCTTGKSHFYPGLC 249
            |.:||::     .:.|::..|:   |:|||:.. ..|....|..|...|.|  |:......||
Mouse   154 FKIGCAV-----SNCPNLTRYSAGLFVCNYSPTGNFLDFRPYRKGDPCSMC--GQRKCENSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 44/159 (28%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.