DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and PI15

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:240 Identity:63/240 - (26%)
Similarity:94/240 - (39%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TGNF-----HRRCQPDAVQVDVSRHK--------ADFLHAHNKRRNFLALGKVPGYYPAARMATM 94
            |.||     ..:.|.|:..:..:|.|        ...|..||:.|     |||  :.|||.|..|
Human    34 TNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVR-----GKV--FPPAANMEYM 91

  Fly    95 VWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCA-VWRPRSPHVNVTSLVEECLGLWFNE 158
            |||:.|...:.....||..||..   :|.....||||.. ..|.||    :..||:.    |::|
Human    92 VWDENLAKSAEAWAATCIWDHGP---SYLLRFLGQNLSVRTGRYRS----ILQLVKP----WYDE 145

  Fly   159 FDLIDSSFIDSFKVTPIFED---------YG----HFAELSVDKNFAVGCSIMRFTRPD-YPSVY 209
              :.|.:|       |..:|         :|    |:.::....:..:||:|......: :.||:
Human   146 --VKDYAF-------PYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVW 201

  Fly   210 ---IYNFICNYASL-YALGAPVYETGRAASRCTTGKSHFYPGLCS 250
               :| .:||||.. ..:|...|:.|...|.|...    |.|.|:
Human   202 RRAVY-LVCNYAPKGNWIGEAPYKVGVPCSSCPPS----YGGSCT 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 47/180 (26%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 46/172 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151198
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.