DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and Ag5r2

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_524689.2 Gene:Ag5r2 / 44079 FlyBaseID:FBgn0020508 Length:254 Species:Drosophila melanogaster


Alignment Length:264 Identity:93/264 - (35%)
Similarity:139/264 - (52%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVS-RHKADFLH 68
            |..|||  ||..|.||:...:|..|:| ||..||||..:..:...|..||..:|:: .:|..|:|
  Fly     3 LALLAI--LIVSLALAQATDYCSSDIC-NGGSHIACGHSNWWDSSCPGDAELIDINDDYKWVFVH 64

  Fly    69 AHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCA 133
            :||.:||::|.|....:..|.|||||.|||||.||:.||.|.|.:.||.||||..:..|||||  
  Fly    65 SHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNTDAFKYSGQNL-- 127

  Fly   134 VWRPRSPHV-NVTSLVEECLGLWFNEF-----DLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFA 192
            .|:..|..: ::..:::..:.:||:|.     .:|...:...:....|    |||..:..::|..
  Fly   128 AWQAYSGDLPDMGYILDNSVQMWFDEVHNSNAGIIAGGYPSGYNGPAI----GHFTVMMSERNTR 188

  Fly   193 VGCSIMRFTRPDYPSVYIYNFICNYASLYALGAPVYET-GRAASRCTTGKSHFYPGLCSTREVYD 256
            :||:..|:.|..:..|.:   .||||:...:|..:|.: ...|..|.:|.:..:..||||.|.||
  Fly   189 LGCAAARYNRDGWNQVLV---ACNYATTNMIGRQIYSSCDWGAQGCGSGTNGEFGNLCSTSEWYD 250

  Fly   257 PN-W 259
            .| |
  Fly   251 VNSW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 55/160 (34%)
Ag5r2NP_524689.2 SCP_euk 62..211 CDD:240180 54/157 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440524
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 1 1.000 - - otm50802
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.