DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and scpr-A

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:259 Identity:85/259 - (32%)
Similarity:130/259 - (50%) Gaps:21/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FQLIFQLIL--------AKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFL 67
            |..:.||||        |.||  |....|.:  :|:||...|||...|..|..:|.:..|....|
  Fly     3 FTKVLQLILLAVVAISSAVDY--CALPTCLD--KHVACNNKGNFSENCPKDVREVKIEPHHKLIL 63

  Fly    68 HAHNKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLC 132
            :..|:.||.:|.||:.|...|.|||.|.|.:||.:|::||.:||:...|.|.:|.|:|.:||| .
  Fly    64 NLFNELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN-N 127

  Fly   133 AVWRPRSPHVNVT--SLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFAVGC 195
            |:::........|  .:::|.:..||.|........:.||......:....|.....:||..|||
  Fly   128 ALFQYSGAETEYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGC 192

  Fly   196 SIMRFTRPDYPSVYIYNFICNYASLYALGAPVYETG-RAASRCTT--GKSHFYPGLCSTREVYD 256
            :.:||:| |:.:.::  ..||:|:...:|.|||..| :|.:.|..  |.::.||.||..:|:||
  Fly   193 AAVRFSR-DFYNHFV--LTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 49/156 (31%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440543
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.