DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and scpr-B

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650061.1 Gene:scpr-B / 41357 FlyBaseID:FBgn0037888 Length:262 Species:Drosophila melanogaster


Alignment Length:255 Identity:84/255 - (32%)
Similarity:130/255 - (50%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHN 71
            ||.:...:..:.||.||  |....|.:  :||||...|||...|..|..:|.:..|....|:..|
  Fly     5 CLILLTSLLGISLAADY--CALPTCLD--KHIACNNKGNFSENCPKDVREVKIEPHHKLILNLFN 65

  Fly    72 KRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWR 136
            :.||.:|.||:.|...|.|||.|.|.:||.:|::||.:||:...|.|.:|.|:|.:||| .|:::
  Fly    66 ELRNNVAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQN-NALFQ 129

  Fly   137 PRSPHVNVT--SLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNFAVGCSIMR 199
            ........|  .:::|.:..||.|........:.||......:....|.....:||..|||:.:|
  Fly   130 YSGAETEYTDAEIIKEQIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVR 194

  Fly   200 FTRPDYPSVYIYNFICNYASLYALGAPVYETG-RAASRCTT--GKSHFYPGLCSTREVYD 256
            |:| |:.:.::  ..||:|:...:|.|||..| :|.:.|..  |.::.||.||..:|:||
  Fly   195 FSR-DFYNHFV--LTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLCYAKEIYD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 49/156 (31%)
scpr-BNP_650061.1 SCP_euk 58..210 CDD:240180 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440555
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.