DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG11977

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:196 Identity:51/196 - (26%)
Similarity:86/196 - (43%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ILAKDYSWCDPDLCGNGVRHIAC------RTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNF 76
            |..|...:|:.|:|....:||.|      ...|..|...:....:.|:.|:..:|     :|:..
  Fly    37 IPVKPPDYCNADICPANKKHITCGFKFWSTKCGRNHEGVRMSDYRYDIVRNVNNF-----RRKLE 96

  Fly    77 LALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDH--DDCHNTYRYANSGQNLCAV-WRPR 138
            ..||.:|   .|.:...:.|||||..::|..:..| |.|  ..|.||:.|.:.|::...| .:..
  Fly    97 WGLGNLP---RAVKFKNIKWDDELSVMAMRVSNQC-LQHTFSPCVNTFLYKDVGESSDFVKVQNT 157

  Fly   139 SPHVNVTSLVEECLGLWFNEFDLIDSSFIDSF-KVTP----IFEDYGHFAELSVDKNFAVGCSIM 198
            |...||.|.    |.:||....::..|::::| .:.|    |.     ||.|..:||..:||.::
  Fly   158 SKGFNVISF----LNMWFEYHKMMKPSYVNNFPNIAPQDRLII-----FANLIYEKNKKMGCGMV 213

  Fly   199 R 199
            :
  Fly   214 K 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 39/145 (27%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.