DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG31482

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster


Alignment Length:131 Identity:35/131 - (26%)
Similarity:49/131 - (37%) Gaps:39/131 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DFLHAHNKRRNFLALGKVPGYYPAARMATMVWDDEL-----QYLSMLNTRTCKLDHDDCHNTYRY 124
            |.|:.||:.|.  ..|..|          :..||||     :|..:|.... ||:|.....    
  Fly    25 DHLNEHNRLRE--KHGSPP----------LTLDDELTKGCEEYAKVLANNE-KLEHSSSAG---- 72

  Fly   125 ANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNEFDLIDSSFIDSFKVTPIFEDYGHFAELSVDK 189
            .|.|:|||  .|.::|        .:|:..|::|....|      |:........|||..| |.|
  Fly    73 QNYGENLC--MRSQTP--------LQCVQDWYDEIADYD------FEKPQFAMSTGHFTAL-VWK 120

  Fly   190 N 190
            |
  Fly   121 N 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 35/131 (27%)
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 35/131 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.