DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG42564

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:242 Identity:76/242 - (31%)
Similarity:127/242 - (52%) Gaps:18/242 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADF-LHAHNKRRNFLALGKVPGY 85
            ||  |||.||...::|:||..:...|.:|..||..:.:|.....| |...|:.|:.:|.|...|.
  Fly    54 DY--CDPSLCHKELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGL 116

  Fly    86 YPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNL-CAVWRPRSPHVNVTSLVE 149
            .||:||.|:.|:.||.||:..|.|.|.|.||:|.||....|:||.: ....:.:.|.:.  .::.
  Fly   117 SPASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIKGKLPELE--DILR 179

  Fly   150 ECLGLWFNE---FDLID-SSFIDSFKVTPIFEDYGHFAELSVDKNFAVGCSIMRFTRPDYPSVYI 210
            :.:|:|..|   ..::: ..:::....:|.:    :|.::.::...:|||:|::.:|..:...: 
  Fly   180 DIIGVWLREKSRTSMVNIMKYVEQESQSPKY----NFLQIVLENAESVGCAIVQQSRHGWIQTF- 239

  Fly   211 YNFICNYASLYALGAPVYETG-RAASRCTTGKSHFYPGLCSTREVYD 256
              |.|||.....:|:||||.| :||..|.||.:..|..||:..|||:
  Fly   240 --FACNYGHAPVVGSPVYEPGKKAAESCKTGANPKYAHLCAESEVYE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 43/160 (27%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 43/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440576
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.