DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG8072

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:269 Identity:72/269 - (26%)
Similarity:113/269 - (42%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ICLAIFQLIFQLILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAH 70
            :|..:|   .:.|||.|:  ||...| :|.|||.|.....|...|......|:::..:...|..|
  Fly    10 LCKILF---LRSILAIDF--CDIKSC-HGKRHIGCDNNMMFDESCLRFHGLVNMAYFREYLLGLH 68

  Fly    71 NKRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLD--HDDCHNTYRYANSGQNLCA 133
            |..|..:|........||.:|..:|||:.|..::..:.:.|::|  .|.|..|..::....|...
  Fly    69 NGYRQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLPDDSCVATDDFSEPHFNYAE 133

  Fly   134 VWRPRSPHV------NVTSLVEECLGLWFNE-FDLIDSSFIDSFKVTPIFEDYGHFAELSVDKNF 191
            .:.|| |.:      .:|.|.|:    |.:| :||.|.:         .:...|....:..|::.
  Fly   134 DFYPR-PVIRQSNVREMTILAEQ----WLDELYDLDDIA---------TYSAEGEIRNIINDRSS 184

  Fly   192 AVGCSIMRFTRPDYPSVYIYN----FICNYASLYALGAPV----YETG-RAASRCTTGKSHFYPG 247
            .:||:    ...||.   ::|    .:|.|:|    |.||    ||.| ..|:.|..|:|..||.
  Fly   185 YMGCA----AGQDYD---LWNIHFVLVCYYSS----GPPVEGNLYEEGIFNATLCPNGQSDEYPN 238

  Fly   248 LCSTREVYD 256
            ||.|..:.|
  Fly   239 LCKTLTLND 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 37/167 (22%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440667
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.