DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG34049

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:130 Identity:34/130 - (26%)
Similarity:47/130 - (36%) Gaps:49/130 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 WDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLGLWFNE-- 158
            |.|.|..|:.|.||...|             .|:|:..|.|.:..       |::.|.||:.|  
  Fly   178 WADHLADLNKLETRPNPL-------------YGENIMRVRRSKFS-------VDQILKLWYQEKY 222

  Fly   159 -FDLIDSSFIDSFKVTPIFEDY-GHFAEL----SVDKNFAVGCSIMRFTRPDYPSVYIYNFICNY 217
             :|.:          .|.|..| |||.:|    |......|.|        |..|::|   :|||
  Fly   223 NYDYL----------KPGFNLYTGHFTQLVWRESEFLGVGVAC--------DVSSIWI---VCNY 266

  Fly   218  217
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 34/130 (26%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 34/130 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455115
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.