DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and R3hdml

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:256 Identity:58/256 - (22%)
Similarity:88/256 - (34%) Gaps:95/256 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LCGNGV------RHIACRTTGNFHRRCQPDAVQVDVSRHKADFLHAHNKRRNFLALGKVPGYYPA 88
            |.|.||      |||:.|                |::.    .|..||..|..:       :.||
  Rat    44 LSGLGVPRHRRKRHISAR----------------DMNA----LLDYHNHIRASV-------HPPA 81

  Fly    89 ARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRPRSPHVNVTSLVEECLG 153
            :.|..||||::|...:......|...|.....| :|.  ||||       |.|          .|
  Rat    82 SNMEYMVWDEQLARAAEAWATQCIWAHGPSQLT-KYV--GQNL-------SVH----------SG 126

  Fly   154 LWFNEFDLIDS--------SFIDSFKVTPIFED-------------YGHFAELSVDKNFAVGCSI 197
            .:.:..||:.|        ||       |..:|             ..|:.::....:..:||:|
  Rat   127 RYRSVVDLVKSWSEEKRHYSF-------PAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLGCAI 184

  Fly   198 MRFTRPD------YPSVYIYNFICNYA-SLYALGAPVYETGRAASRCTTGKSHFYPGLCST 251
            ...:..:      ..:||:   :|||| ....:|...|:||:..|.|...    |.|.|::
  Rat   185 HTCSSINVWGSTWQQAVYL---VCNYAIKGNWIGEAPYKTGKPCSACPPS----YQGNCNS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 38/181 (21%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 37/182 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344651
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.