DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17974 and CG10651

DIOPT Version :9

Sequence 1:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:271 Identity:75/271 - (27%)
Similarity:108/271 - (39%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIFQLILAKDY----SWCDPDLCGNGVRHIACRTTGNFHRRC-QPDAVQVDVSRHK-ADFLHAHN 71
            |:|..:..:|.    .||..|||..  :|:.|...|||...| :..|..|.:|... |..:..||
  Fly     7 LLFSTLYIQDTGASDKWCKADLCRG--QHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHN 69

  Fly    72 KRRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWR 136
            :.||..| |.:.....||||.|:.||.||..::....|.|:...|.|..|..|.           
  Fly    70 EYRNKFA-GGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYG----------- 122

  Fly   137 PRSPHVNVTSLVEE--C-----------LGLWF--NEFDLIDSSFIDSFKVTPIFEDYG-HFAEL 185
                |..|:..:|:  |           |..||  |..|.:...|   |..|...::.. ::.::
  Fly   123 ----HAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLF---FSWTKNQQELSKNYFQV 180

  Fly   186 SVDKNFAVGCSIMRFTRPDYPSVY-----IYNFICNYASLYALGAPVYE--TGRAASRCTTGKSH 243
            ..|:...|||:|:.:.||  ..|:     :||  |..:.......||||  ...|||.|..|.:.
  Fly   181 LRDRANRVGCAIVEYVRP--ALVHQLLKCVYN--CGVSLCEEEDNPVYEDTDEEAASECMKGSNK 241

  Fly   244 FYPGLCSTREV 254
            .|..||...|:
  Fly   242 QYKNLCHKDEL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 45/176 (26%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.